SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000013831 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000013831
Domain Number 1 Region: 108-163
Classification Level Classification E-value
Superfamily RING/U-box 6e-17
Family ZZ domain 0.014
Further Details:      
 
Domain Number 2 Region: 388-436
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000816
Family UBA domain 0.00027
Further Details:      
 
Domain Number 3 Region: 15-81
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000687
Family PB1 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000013831   Gene: ENSLACG00000012177   Transcript: ENSLACT00000013928
Sequence length 441
Comment pep:known_by_projection scaffold:LatCha1:JH126815.1:685520:705225:-1 gene:ENSLACG00000012177 transcript:ENSLACT00000013928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTVKAYLLGKEDCKKEIRRFGVDLEVSASFSFLTQKVIEVFQSLKEGCFQLYYQDEEG
DMIAFSSDEELVMALGSVKDDMFRIFIKERKECRREFRQQWNQERLNNILHPNVICDGCD
GPVTGTRFKCVVCPNYDLCGGCKEKAVHKEHEMIAIPTPLAYLSQWMPPGPWFHRMRRGF
PHCPRTAGLPPHHPCGPCPNTGKSAPNSKPQASETQQAGASDTPPQNPGLSYLQSIGESV
ASLLSPLGIDVDIDVEHGAQRTKVTPAKPKSEGQDSHQDPAPADQNRQKKSSQDSKAVLV
EEELPGSPMEVAEKAETNEPSETGSTLGSDEEWTHLSPKEVDPSTGELQSLRAQGAEGPH
SLNLSEESAVCQEGPSGLREAAVYPHLPPDADPRLIETLSHMLSMGFNDEGGWLTQLVQA
KNYDIGAALDAIQYPKQPDRK
Download sequence
Identical sequences H3AW10
ENSLACP00000013831 XP_005995405.1.90931 ENSLACP00000013831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]