SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000013888 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000013888
Domain Number 1 Region: 1-161
Classification Level Classification E-value
Superfamily RUN domain-like 2.75e-29
Family RUN domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000013888   Gene: ENSLACG00000012227   Transcript: ENSLACT00000013985
Sequence length 924
Comment pep:known_by_projection scaffold:LatCha1:JH127352.1:691785:727520:1 gene:ENSLACG00000012227 transcript:ENSLACT00000013985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HWKLLASLKTTVDGLVSANNPNVWSKYGGLERLCRDMNNILLHGLLPDQVYCTQRDFWPF
VKHVRWVCPHLSCHIDQFLNLEGESCSSARTDQHKAQRWLQHSLQFHCLSVQLKPLLSSY
NFSRKFYSDSAFLLDHAYVTAMFQCLEAVEQNDPKLLAQIDTSMFTSKSDPSLTKLKSQS
LTALPGSRWVPPADGVHRRYTTCYSSLPRIPSAMSGPLDTRWESWLSNDSGVSQHDSLRQ
FQLSLWGERPGPDPPVSENPQLMVSCPSDALLSINEAHSSTPNSPSEDPLSDVDDGPEYL
AIGNLGRRVRASSQGSIKSASSNSLSSQKAEGQATAGGSTRSSSLLNHPRRSSFSEGQNL
MPQGCLKKSHARSHSDTGLDAAKLPESHADGSKLKDVGAFSSPSSELSTPSSLYMEAEGA
HYLNAADGMFRRPSEGQSLISYLAEQDFGSCADLEKENAHFSISESLIAAIELMKCNLMI
RRLQEEEEEEEESDKEIQELKQKIRIRRQQIRTSKLLPRYKDESDNFPTTDSGSQISSRD
STQLSDSGSTDGVDEYELRDADIRKSLTAGSSKHFLSSEPICSSFFHSNSAEAVAMGLLK
QFEGMQLPAASELDWLVPEHDAPQKLLPIPNSLPISPDDGEHADIYKLRIRVRGNLEWAP
PRPQIIFNIHPSPKRKVIVAKQNYRCAGCGIRTDPDFIKRWRYCEYLGKYFCQCCHDNAQ
SIIPSRLLRKWDFSKYYVSNFSKDLLSKIWNDPLFNIQDINTALYRKVKALEQVRLLRIQ
LVHLKTMFKTCRLAKDLLDLYDTEPGHLTEDLHLYSLSDLTATRKGDLVQRLKELVKPGI
AHVENCVLCQAKGFICEFCGNEKDIIFPFQLNKCKRCEVECKSCYHKSCFRSEQCPKCDR
MQARRELLARQNMEPYASEPEEGD
Download sequence
Identical sequences H3AW67
ENSLACP00000013888 ENSLACP00000013888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]