SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015650 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015650
Domain Number 1 Region: 4-167
Classification Level Classification E-value
Superfamily RUN domain-like 5.49e-25
Family RUN domain 0.0051
Further Details:      
 
Domain Number 2 Region: 163-256
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000434
Family PDZ domain 0.023
Further Details:      
 
Domain Number 3 Region: 293-423
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000578
Family Phosphotyrosine-binding domain (PTB) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015650   Gene: ENSLACG00000013777   Transcript: ENSLACT00000015758
Sequence length 429
Comment pep:known_by_projection scaffold:LatCha1:JH127282.1:908644:944315:1 gene:ENSLACG00000013777 transcript:ENSLACT00000015758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKDPLLGTLKACILNIQREDGPVTDQNPHLSSFCEILEIILRKGMKQPVLSLKGRDYW
NWMEQLSHQDFCGRLTQLCRALEKVASCKKVLTAQGRGRFMLRLALNMRILSSVITHLTH
TPKLMQWYDPAISVFGNEALMEPFFSLLLVVSEMNFALDLENSSFLDESWLLPLHETYEI
VPCRELGITLRYLDGRVFVLELIPGGQADVDEVVLLGDIIDEINGVSLRNAGNGEAGTVL
QKFKGKPLNFRLIRWKWHDGTVYKPMVMHLKLLQQEYPNFQLNYDRKCREKNDSACLQDG
RVLYGLRYLGQTNVGMFGGKEILDQGILTVLEQQISPKDVLLDVKETELLCTEKTSSQVL
FHYPYPEISCVGRRVGKNNTVFAFCASDSPDAPEHCTFNCLVLKANSEKECDEIIKRIAI
GFKHTEWFV
Download sequence
Identical sequences H3B179
ENSLACP00000015650 ENSLACP00000015650 XP_006001744.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]