SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016172 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016172
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 9.02e-59
Family Dystroglycan, domain 2 0.000000745
Further Details:      
 
Domain Number 2 Region: 501-604
Classification Level Classification E-value
Superfamily Cadherin-like 2.04e-18
Family Dystroglycan, N-terminal domain 0.019
Further Details:      
 
Domain Number 3 Region: 64-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000643
Family Dystroglycan, N-terminal domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016172   Gene: ENSLACG00000014245   Transcript: ENSLACT00000016284
Sequence length 900
Comment pep:known_by_projection scaffold:LatCha1:JH126569.1:990597:1028613:1 gene:ENSLACG00000014245 transcript:ENSLACT00000016284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVKFVPFLHRLGWTLFLGLLAAAPAHGSWPNGPVEIVRDLGNQIEASMHSVLLDIRETV
APPAGIPDKSAVVGRVFQMTIPSEMLSVNGQQIKVTEAGKESLPSWLHWKPERSILQGLP
LDTDKGVHYISVSAMQLSTNGSLVPQATEGFSIEVLPEDHADTLASRMVLQDTNEVISFF
CTAEEPVTILTVILDADLIKMTPKQRVELLSRMRKFSEVELHFMKLVPVVNNRLFDMSAF
MAGPGNAKKVVENGALLSWKLGCSLDQNSIPNISKVEAPAKEGTMSAQLGYPVVGWHIAN
KKPHLPKRVRRQIHVTPTPSIVFSPPTTATQEPPTRIVPTPTSPAIAATTETVATPVRGP
VPLPGKPTVTIRTKDALAHTPTLGPIQPTRVMETTSTVPGQIQPTVTRPGYIEPTAVATP
PTTTTKKPRVFTAKPGKPATTTSPTATTRKTKKVKTPRPKVSSTTKATTTKGQTTSAPSG
RRTTTFVTTRPIHGPDYQNTPPVLTNHIDRVDAWVGTYFEVKIPSDTFYDKQDGTTDKLR
LTLKLKEQQIVGENSWVQFNSTSQLMYGLPDYVHVGKHEYFMHATDKGGLSATDAFEIHV
HKRPHGEKSSVKFAARFQGDHMSIVNSVNKKIQMVKKLAYAFGDRNSSTITLQNITKGSI
VVEWTNNTLPLDPCPKEQIQALSKKIADDKGKPSLSFSSAMKPDYTPMSISVTGTGSCQN
IQFVPLVEGKIPAPVTPSSPARDLGPGRTSQDDVYLHTVIPAVVVAAILLIAGIIAMICY
RKKRKGKLTIEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQI
TPETTPLNQDLMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences H3B2Q1
ENSLACP00000016172 XP_005987058.1.90931 XP_005987059.1.90931 XP_005987060.1.90931 XP_005987061.1.90931 XP_005987062.1.90931 XP_005987063.1.90931 XP_005987064.1.90931 XP_014344065.1.90931 ENSLACP00000016172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]