SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016323 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016323
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Hormone receptor domain 6.15e-28
Family Hormone receptor domain 0.001
Further Details:      
 
Domain Number 2 Region: 101-399
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000101
Family Rhodopsin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016323   Gene: ENSLACG00000014381   Transcript: ENSLACT00000016437
Sequence length 412
Comment pep:novel scaffold:LatCha1:JH126596.1:1015796:1028684:1 gene:ENSLACG00000014381 transcript:ENSLACT00000016437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSEYENECMRKMETEPPPSAALFCNRTFDNYACWPDAVGDVMVKVPCPPYLPWIDKVSTG
HVYRKCTLNGTWLLLENSSLPWRDFSECQEDSATGQERETQWMYLEILRIIYTVGYSLSI
VLLSVAICILLSFRRLHCLRNSIHLNLFVTFLLRAVTVLVKDGLLRQSYSAPYVSPPDWQ
TFPNTKALFSCRTAQVLMQYCIGVNYFWLLCEGIYLQALLSASNLSKNNCLRYYILFGWG
TPVLFVVPWVTVKYMLENEECWLRNISMGVWWIMRAPLLAALIINFLIFIRIFLLLVSRL
HSNRLTFSNSKQRLAKVTLTLIPLLGLHETLFAFVTDESAVGLLRTVKLFYELLLSSVQG
CIVTVLYFFTNPEVQPELRKFWEKLRGKRDSRTEVFHTQSGSESVGCASQFE
Download sequence
Identical sequences H3B352
ENSLACP00000016323 ENSLACP00000016323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]