SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016583 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016583
Domain Number 1 Region: 27-203
Classification Level Classification E-value
Superfamily TIMP-like 3.53e-51
Family Tissue inhibitor of metalloproteinases, TIMP 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016583   Gene: ENSLACG00000014615   Transcript: ENSLACT00000016697
Sequence length 216
Comment pep:known_by_projection scaffold:LatCha1:JH126590.1:1062437:1130919:1 gene:ENSLACG00000014615 transcript:ENSLACT00000016697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLFVSVFFSLLLALSSWNLSQFVEACTCVPNHPQDAFCNSDIVIRAKVVGKKLMKDGPF
GTMRYTIKQTKMYKGFNKVSHVQFIYTEASESLCGVKLEVNKYQYLITGRVYGGKVYTGQ
ILFFFAARMTNKVSSGRPSSNLAYTLSCSTKIKPCYYLPCLVTSKNECLWTDMITNFGHP
GHQSKHYACIQQKEGYCSWYRGWAPPDKTSINTTDP
Download sequence
Identical sequences H3B3W2
ENSLACP00000016583 ENSLACP00000016583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]