SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017643 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017643
Domain Number 1 Region: 49-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000248
Family Hairy Orange domain 0.00006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017643   Gene: ENSLACG00000015540   Transcript: ENSLACT00000017773
Sequence length 304
Comment pep:known_by_projection scaffold:LatCha1:JH126955.1:1285792:1290037:1 gene:ENSLACG00000015540 transcript:ENSLACT00000017773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRTHDYSSSDSELDETIEVEKESADENGNLSSAPGSMSPTTSSQVLARKRRRGIIEKRR
RDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHAAGGKGYFDAHALAMD
YRSLGFRECLAEVARYLSIIEGLDGSDPLRVRLVSHLNNYATQREAATGAHPGIGHLPWG
AAFGHHPHLSHPLLLPQSSHSSTNTTASSAEPHHQSRIAASSHSDTSSLRVPPTGSIVPG
ISVVSSASKLPPPLLSSVPSLSTFPFSFGAFHLLSPNTLSPSVPTQSASLGKPYRPWGKE
IGAF
Download sequence
Identical sequences H3B6X2
ENSLACP00000017643 ENSLACP00000017643 XP_005997604.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]