SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017682 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017682
Domain Number 1 Region: 525-893
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.37e-128
Family Hect, E3 ligase catalytic domain 0.00000000485
Further Details:      
 
Domain Number 2 Region: 19-160
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.14e-28
Family Synaptotagmin-like (S variant) 0.076
Further Details:      
 
Domain Number 3 Region: 469-508
Classification Level Classification E-value
Superfamily WW domain 0.00000000000000157
Family WW domain 0.00022
Further Details:      
 
Domain Number 4 Region: 342-381
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000695
Family WW domain 0.0014
Further Details:      
 
Domain Number 5 Region: 182-220
Classification Level Classification E-value
Superfamily WW domain 0.00000000000376
Family WW domain 0.0014
Further Details:      
 
Domain Number 6 Region: 417-457
Classification Level Classification E-value
Superfamily WW domain 0.0000000000208
Family WW domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017682   Gene: ENSLACG00000015574   Transcript: ENSLACT00000017812
Sequence length 900
Comment pep:known_by_projection scaffold:LatCha1:JH126859.1:1294394:1376150:-1 gene:ENSLACG00000015574 transcript:ENSLACT00000017812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSALEVRGLPVDEEQSRILRAKVLAGIGLAKKDIFGASDPYVRVSLYDPVSGELTSVQT
KTIKKTLHPKWNEEFLFRVFPRQHRLLFEVFDENRLTRDDFLGKVDVPLHHIPTENPNTE
RPYSFKDFLLHPRSYKSRVKGHLRLKMAYLPRNGTDEEGTEQPEDLETGWEMIDQQDTAG
YSQQVPSLPPGWEEKQDNLGRTYFVNHETRITQWQRPASQEIVADTDHGRSLLLEAQHVF
TNRRQISEQTENSENDSPDGWEVVTEDEATVYSNRNSQSPPPPHSLTAQSTFGTDLVEEL
NRRLNTSVNIVPDEHGSCSSHSSRRESTQATTFEEQPAQPVLLPTSAGLPPGWEEKQDDK
GRIYYVNHNNRTTTWTRPVLQTTTEAAQSASCQSATVTHPSQLSPKDSPEQSPQQALIHT
YGFLPSGWEICHAPNGKSFFIDHNTQMTTWEDPRLKIPVHMRKQPSLDPSDLGPLPPGWE
ERVHSDGRVFYIDHNTKTTQWEDPRLQNVAVTGPAVPYSRDYKQKYEYFRKKLKKPTEIP
NRFEMKLRRSAVLEDSYRHIISVKRPDLLKARLWIEFENEKGLDYGGVAREWFFLISKEM
FNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMSVYHGKLLDGFFIRPF
YKMMLQKPITLNDMESVDSEYYNSLKWILENDPTDLDLRFIIDEEFFGQTQQHELKTGGA
DIVITNKNKREYIHLVIQWRFVDRIQKQMAAFKEGFYELIPQDLIKIFDENELELLMCGL
GDVDVNDWRENTKYKNSYHANHPVIQWFWKTVLLMDSEKRIRLLQFVTGTSRVPMNGFAE
LYGSNGPQLFTIEQWGTPDKLPRAHTCFNRLDLPPYESFEDLREKLHTAIENAQGFDGVD
Download sequence
Identical sequences H3B711
XP_005996231.1.90931 ENSLACP00000017682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]