SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017711 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017711
Domain Number 1 Region: 261-454
Classification Level Classification E-value
Superfamily Nudix 4.33e-43
Family NADH pyrophosphatase 0.0018
Further Details:      
 
Domain Number 2 Region: 16-101
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.39e-18
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017711   Gene: ENSLACG00000015599   Transcript: ENSLACT00000017841
Sequence length 460
Comment pep:known_by_projection scaffold:LatCha1:JH126726.1:1299590:1333930:-1 gene:ENSLACG00000015599 transcript:ENSLACT00000017841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTLGSPKQEMVAQLHAFAARGDAVQLATVLNHSASLLNETGTHGWTALMYGARNGHLN
VVKILLEKGCDKLIVNKSGQTALDIAKFWGHKHIAGLLQSAQGGQQPWFLPDAVEEHENY
FNRTLLDRSSQKRTDSEWLKAKQTCPISVYILFSNLAPLVVSSPGEDDSSHPEVRLCRLK
EEDIKELLSKSEEDLLIFLGVEKPENLMFLEKKNGSVEDDGLLAWFALNLDSVPVEQFKQ
KYKNCYFLQPPMPGLLQLTEEEAGVVAQARSVLAWHKRYRFCPTCGGATKIEEGGYKRTC
LKAECPSLQGVHNTAYPRVDPVVIMLVIHPDGNKCLLGRKKQFPPGMFSCLAGFIEPGET
IEDAVRREVEEESGIRVGHAQYVSCQPWPMPCSLMIGCLAVAVSTEIKVDMNEIEEARWF
TREQVVDALTKQDKRPFFVPPRQAIAHQLIKYWIGMNSNL
Download sequence
Identical sequences H3B740
ENSLACP00000017711 XP_005993524.1.90931 XP_005993525.1.90931 XP_014342406.1.90931 ENSLACP00000017711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]