SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018255 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018255
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.96e-24
Family Hormone receptor domain 0.0000638
Further Details:      
 
Domain Number 2 Region: 44-347
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000065
Family Rhodopsin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018255   Gene: ENSLACG00000016080   Transcript: ENSLACT00000018387
Sequence length 376
Comment pep:known_by_projection scaffold:LatCha1:JH126776.1:1447250:1555851:-1 gene:ENSLACG00000016080 transcript:ENSLACT00000018387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGPYCNASRDLIGTCWPRSAVDLLIARPCPEYFYGVRYNTTNNIYRECFPNGTWAARVNY
SQCQEILNEEKKSKLHYHIAVIINYLGHCISLGALLIAFILFMRLRSIRCLRNIIHWNLI
TAFILRNATWFVVQLSMNTKVHESNVIWCRLITAAYNYFHVTNFFWMFGEGCYLHTAIVL
TYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLFYDNEKCWFGKRAGVYTDYIYQGPMILV
LLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEV
SQIVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHSIRARVARAMSIPT
SPTRVSFHSIKQSTAV
Download sequence
Identical sequences H3B8N4
ENSLACP00000018255 ENSLACP00000018255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]