SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018379 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018379
Domain Number 1 Region: 189-463
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.92e-79
Family Mitochondrial carrier 0.0000592
Further Details:      
 
Domain Number 2 Region: 29-181
Classification Level Classification E-value
Superfamily EF-hand 4e-29
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018379   Gene: ENSLACG00000016187   Transcript: ENSLACT00000018512
Sequence length 472
Comment pep:known_by_projection scaffold:LatCha1:JH126718.1:1480242:1494890:-1 gene:ENSLACG00000016187 transcript:ENSLACT00000018512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCLCLYVPVADSAPHSEFQYFESDGLPSELQAVISRLSIFVSSHEFTTYRRWRQQKIVK
AGDKDLDGQLDFEEFVHYLRDHEKKLRLVFKSLDRKNDGQIDAQEITQSLRDLGVHISEQ
QAEKILRSMDKNGTMTIDWNEWRDYHLLHPAENIPEIILYWKHSTIFDVGENLTVPDEFT
AEEKQTGMWWRQLVAGGAAGAVSRTCTAPLDRLKVLMQVHASRANNMCIAGGFTQMIREG
GIRSLWRGNGINVLKIAPETAIKFMAYEQIKHLIGSNQETLRIHERLIAGSLAGVIAQSS
IYPMEVLKTRLALRKTGQYTGMLDCAKQILRKEGLSAFYKGYIPNMLGIIPYAGIDLAVY
ETLKNAWLQHYATSSADPGIFVLLACGTVSSTCGQLASYPLALVRTRMQAQATMEGAPKV
TMSGLFRHILKTEGAVGLYRGLAPNFMKVIPAVSISYVVYENLKMSLGVQSR
Download sequence
Identical sequences H3B908
ENSLACP00000018379 XP_005993320.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]