SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018598 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018598
Domain Number 1 Region: 76-124
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000034
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 2 Region: 37-79
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000471
Family Somatomedin B domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018598   Gene: ENSLACG00000016377   Transcript: ENSLACT00000018731
Sequence length 263
Comment pep:novel scaffold:LatCha1:JH126675.1:1554422:1602016:1 gene:ENSLACG00000016377 transcript:ENSLACT00000018731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSRLFAVICVGFILVNPRSQAGCRDEGFCCTSRNHTCVSTGWRADRSYGTCYCDQACS
KALDCCHDYSEACPAVSCTVSEWSSWSGCAEPCKATYRVRRRQLMQEPRNGGDQCPPLEE
KAGCAEYWNRQRVECRQSLVPALITTGGYGKARKRRDVSSENEKTGYCVEFQLKSLAPAC
ILENKAYSRWMQYLREGHTVCVECQPPALNFRSQHCYGDGVGAKKNQLLEWQAVGNPQCR
GSWKRIRQRDSCSCPTVHSFLFV
Download sequence
Identical sequences H3B9M7
ENSLACP00000018598 ENSLACP00000018598 XP_005992107.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]