SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018613 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018613
Domain Number 1 Region: 1016-1107
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-26
Family PDZ domain 0.00026
Further Details:      
 
Domain Number 2 Region: 843-941
Classification Level Classification E-value
Superfamily PDZ domain-like 1.05e-24
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 3 Region: 396-497
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-23
Family PDZ domain 0.0000534
Further Details:      
 
Domain Number 4 Region: 705-813
Classification Level Classification E-value
Superfamily PDZ domain-like 7.89e-23
Family PDZ domain 0.00053
Further Details:      
 
Domain Number 5 Region: 565-664
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-16
Family PDZ domain 0.00044
Further Details:      
 
Domain Number 6 Region: 120-191
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000218
Family Nucleotide and nucleoside kinases 0.0045
Further Details:      
 
Domain Number 7 Region: 287-326
Classification Level Classification E-value
Superfamily WW domain 0.000000000000712
Family WW domain 0.0013
Further Details:      
 
Domain Number 8 Region: 335-371
Classification Level Classification E-value
Superfamily WW domain 0.00000000108
Family WW domain 0.0033
Further Details:      
 
Domain Number 9 Region: 27-110
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000171
Family PDZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018613   Gene: ENSLACG00000016389   Transcript: ENSLACT00000018746
Sequence length 1514
Comment pep:known_by_projection scaffold:LatCha1:JH126576.1:1559252:1747165:-1 gene:ENSLACG00000016389 transcript:ENSLACT00000018746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTLKKKKHWLSKVQECAISWGNSGDLNLMVEIRGGAEFGEFPYLGKIKENVVTYHSGK
APNPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVRPGKVINKDLRHYLSLQFQK
GSIDHKLQQVIRDNLYLRTIPCTTRPPRDGEVPAVDYNFITIEQFKALEESGALLESGTY
DGNFYGTPKPPAEPSPFQPDPVDQVLFDDMFDMEAQRKRTTSVSKMERKDSSVPEEEEEE
EKETGNGSGATELKDKYPVSSGTTRTIPSYSQTSTSMDLRNLNYLTREESLEPLPKNWEM
AYTDTGMVYFIDHNSKTTTWLDPRLAKKSKAPEECDEGELPYGWEKIEDPHYGTYYVDHI
NQKTQFDNPVLEAKKRKQQSLPQGGSHSKPDPERSVFTRDLSQLRGSLIKTSLKKSAMGF
GFTIIGGDRPDEFLQVKNVLKDGPAAQNGKIAPGDVIVDINGTSVLGHTHADVVQMFQLV
PVDQSVDMVLCRGYPLPEDSGEPVVDIVTATPIINGQPVPNMGDTNLCTLDVMSGPTLLN
QSGKAGQNLVNGGLNGLSLDQQEQRTSLASSGSSQTEVVTIPLVKGPKGFGFAIADSPAG
QKVKMILDSQWCRGLQKGDVIKEIYYQNVQGLTHIQVVEVLKQFPVGAEVPLLILREGHN
SPVRSIKPKTEKQETSESSETPNPSETVLQPLPFPPNAVGISSPKLDPSEVYMKSKTMFE
NKPPNTKDLDIFLRKQESGFGFRVLGGDGPDHSIYIGAIIPLGSAEKDGRLRAGDELLLI
DGTPVKGKSHKQVLELMMNAARNGHVALTVRRKVYCAEQLHEDPESQAPVSTQNGSPRIN
HVEMAHKSYPEAYDVLLQRKENEGFGFVILTSKSKPPPGVIPHKIGRVIEGSPADRCGKL
KVGDRISAVNGQSIVALSHDNIVQLIKDAGHTVTLTVIPEEEHRGPPSGNNSARQSPAPQ
HKPMGQSPGNYGTLDRSQLEKEDQKEDSFMVYRHSWSDYKHLPQSDVGQSLAAGSRHSQS
LVCYLVEIERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPT
QGITHTRAIELIQAGGNKVHLLLRTGTGLIPDYGDVGTLIASSTSLKKDNIIYDEQEPSS
SSHFASMPESTHLPIAEEAPMKDKTEKKDFNIPSEEQEENDLKAASFKQSEQKSQAVIKD
SPKNEVRDKSASPRNTKKKIQLEADQDQFGAAERGRSAGSSKLTKEGTKTNQERSPSPSK
TDSRRKALDSKDRHVSLKKGEVKNQSEVSVKGNSQLSRGRSHSPRKPYKNTEHGDKTNRE
KEKATESKNKTASSGKAETHGHTKDRSGRPENPRKESDSRKDISSRIEKQSPERKKKADE
KSASPNKSTESRRKRDENEEKTQTKPSQGTYEEPKPAKCKSLDSLKNNQLEREKAQLRTE
ETDALSTKEQKEKGPERISKNPDKNKKLDEEKPKTQDGTNNTSTSRKTPISPGPWKVPSS
NKVSDATGVTEKHL
Download sequence
Identical sequences H3B9P2
ENSLACP00000018613 XP_005987682.1.90931 ENSLACP00000018613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]