SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018614 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018614
Domain Number 1 Region: 917-1008
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-26
Family PDZ domain 0.00026
Further Details:      
 
Domain Number 2 Region: 744-842
Classification Level Classification E-value
Superfamily PDZ domain-like 9.6e-25
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 3 Region: 298-398
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-23
Family PDZ domain 0.0000543
Further Details:      
 
Domain Number 4 Region: 606-714
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-23
Family PDZ domain 0.00053
Further Details:      
 
Domain Number 5 Region: 466-565
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-16
Family PDZ domain 0.00044
Further Details:      
 
Domain Number 6 Region: 19-90
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000195
Family Nucleotide and nucleoside kinases 0.0045
Further Details:      
 
Domain Number 7 Region: 186-225
Classification Level Classification E-value
Superfamily WW domain 0.000000000000653
Family WW domain 0.0013
Further Details:      
 
Domain Number 8 Region: 234-270
Classification Level Classification E-value
Superfamily WW domain 0.000000000988
Family WW domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018614   Gene: ENSLACG00000016389   Transcript: ENSLACT00000018747
Sequence length 1403
Comment pep:known_by_projection scaffold:LatCha1:JH126576.1:1563274:1636785:-1 gene:ENSLACG00000016389 transcript:ENSLACT00000018747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGKVINKDLRHYLSLQFQKGSIDHKLQQVIRDNLYLRTIPCTTRPPRDGEVPAVDYNFIT
IEQFKALEESGALLESGTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDDMFDMEAQRKRTT
SVSKMERKDSSVPEEEEEEEKETGNGSGATELKDKYPVSSGTTRTIPSYSQTSTSMDLRN
LNYLTREESLEPLPKNWEMAYTDTGMVYFIDHNSKTTTWLDPRLAKKSKAPEECDEGELP
YGWEKIEDPHYGTYYVDHINQKTQFDNPVLEAKKRKQQSLPQGGSHSNLCKDPERSVFTR
DLSQLRGSLIKTSLKKSAMGFGFTIIGGDRPDEFLQVKNVLKDGPAAQNGKIAPGDVIVD
INGTSVLGHTHADVVQMFQLVPVDQSVDMVLCRGYPLPEDSGEPVVDIVTATPIINGQPV
PNMGDTNLCTLDVMSGPTLLNQSGKAGQNLVNGGLNGLSLDQQEQRTSLASSGSSQTEVV
TIPLVKGPKGFGFAIADSPAGQKVKMILDSQWCRGLQKGDVIKEIYYQNVQGLTHIQVVE
VLKQFPVGAEVPLLILREGHNSPVRSIKPKTEKQETSESSETPNPSETVLQPLPFPPNAV
GISSPKLDPSEVYMKSKTMFENKPPNTKDLDIFLRKQESGFGFRVLGGDGPDHSIYIGAI
IPLGSAEKDGRLRAGDELLLIDGTPVKGKSHKQVLELMMNAARNGHVALTVRRKVYCAEQ
LHEDPESQAPVSTQNGSPRINHVEMAHKSYPEAYDVLLQRKENEGFGFVILTSKSKPPPG
VIPHKIGRVIEGSPADRCGKLKVGDRISAVNGQSIVALSHDNIVQLIKDAGHTVTLTVIP
EEEHRGPPSGNNSARQSPAPQHKPMGQSPGNYGTLDRSQLEKEDQKEDSFMVYRHSWSDY
KHLPQSDVGQSLAAGSRHSQSLVCYLVEIERGPRGFGFSLRGGKEYNMGLFILRLAEDGP
AIKDGRIHVGDQIVEINGEPTQGITHTRAIELIQAGGNKVHLLLRTGTGLIPDYGDVGTL
IASSTSLKKDNIIYDEQEPSSSSHFASMPESTHLPIAEEAPMKDKTEKKDFNIPSEEQEE
NDLKAASFKQSEQKSQAVIKDSPKNEVRDKSASPRNTKKKIQLEADQDQFGAAERGRSAG
SSKLTKEGTKTNQERSPSPSKTDSRRKALDSKDRHVSLKKGEVKNQSEVSVKGNSQLSRG
RSHSPRKPYKNTEHGDKTNREKEKATESKNKTASSGKAETHGHTKDRSGRPENPRKESDS
RKDISSRIEKQSPERKKKADEKSASPNKSTESRRKRDENEEKTQTKPSQGTYEEPKPAKC
KSLDSLKNNQLEREKAQLRTEETDALSTKEQKEKGPERIKKPKTQDGTNNTSTSRKTPIS
PGPWKVPSSNKVSDATGVTEKHL
Download sequence
Identical sequences H3B9P3
ENSLACP00000018614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]