SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020565 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020565
Domain Number 1 Region: 437-499,674-793
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.15e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0074
Further Details:      
 
Domain Number 2 Region: 769-892
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.18e-26
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Domain Number 3 Region: 1-48
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000107
Family RUN domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020565   Gene: ENSLACG00000018073   Transcript: ENSLACT00000020705
Sequence length 900
Comment pep:known_by_projection scaffold:LatCha1:JH126574.1:2692892:2731322:1 gene:ENSLACG00000018073 transcript:ENSLACT00000020705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKYYEKEALMADPVCGPILASLLVGPCALEYTKLKTADHYWTDPSADELVQRHRIHGAHG
RQDSPSKRPALGVGIYSIGSCAVHMLAEENVVFLYEKEKKTKTLILKRLSNLQVATKEDV
EAIPGYLSLHQSLEHLTLKWTPNQLMNGTLGDSDFEKSVYWDYALTVPISQIVCIHCHQQ
HCGGTLVLVSQDGIQRPPLHFPQGGHLLAFLSCLENGLLPRGQLEPPLWSQQGKGKVFPK
LRKRNSSNKSVDQDENPDEEIATDYVFRIIYPGRKNDQTVTINYHHLATSRSASIDDDEE
EEDRLHAMISMICSRNLTAPNTMKDPNEMIEMQGFGSLLSWQLGEHCSHASLCLSCSTGS
SPYDIPSCCSCIHDRTPLKMLCENMKRQILSRAFYGWLAYCRHLSTVRTHLSALVNHTII
PPDKPSDASGGLTKDVWSKYQKDMKNYKEVELLRLVYYGGVQHEIRKEVWPFLLGHYRYG
MHKKEMDQVDEEIAAKYQKVMAEWKACEVIVKQREKETHSAIFAKLSSGSSIDSHVQHLI
HRDSTISNDVFMSVDEGDATDLKHQDDLTSTIINTGTPRVIAAEERASVEFDSPDSGFPS
SRNYSVTSGHSNILSSMDDGGEGEPSMDRMDQSTEQAGDSQRVQGPQDSISEDQLCSQLD
LLIARESNSTTFAAAYTIEMLDSVALNLHRIDKDVQRCDRNYWYFSATNLEKLRNIMCSY
VWEHLDVGYVQGMCDILAPLMVILNNEPLAYSCFTQLMKRMCQNFPNGGAMDSHFANMRS
LIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWAAKQISSEHF
VLFIALALVEVYREIIRDNNMDFTDIIKFFNEMAERHDAQQILRIARELVYKVQTLIENK
Download sequence
Identical sequences H3BF94
ENSLACP00000020565 ENSLACP00000020565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]