SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020965 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020965
Domain Number 1 Region: 475-780
Classification Level Classification E-value
Superfamily L domain-like 1.46e-46
Family Ngr ectodomain-like 0.068
Further Details:      
 
Domain Number 2 Region: 5-416
Classification Level Classification E-value
Superfamily L domain-like 6.8e-37
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 3 Region: 878-1022
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 7.19e-31
Family Toll/Interleukin receptor TIR domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020965   Gene: ENSLACG00000018420   Transcript: ENSLACT00000021105
Sequence length 1039
Comment pep:known_by_projection scaffold:LatCha1:JH126569.1:3257903:3261019:-1 gene:ENSLACG00000018420 transcript:ENSLACT00000021105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAGCFLLVSLVMICLSASTLLPYLPCGTMGKTQIDCVDHELTSVPQFIAPTEHITALLLS
RNKIQQISKSSLPNFPNLTCLELSWNCPPVTMRIGNEACELKIDPDAFASLNLHKLNLSG
NSLSMVPTFPSTLKYLNLNYNHILNMDGSTFAGLVNLKYLYMEKNCFYRNPCDIPLNIEN
TTFSELQRLELLSLNNNELVHIPSNLPRSLKKLLLSQNKITSISKVDLNYLRRLKMLDIG
GNCRRCDHASTPCIFCPAGTLNLNPASFSKLHSLEKLMLNDNSLTQLDENLFKPLKQLRW
LDLSNNYLTTEIYNGTVFRQLSRVETLTLSYNYRMKVILDRLSFSESFANMHSLKQLYLS
GIFFRSLDEKAFQPLLQLHHLVRVNLNLNFIDKIPLHLFGRMSSLHYIGLAENEINFPHY
EDCSHKNESYRGEPLSSQPNGQLLSVEKGMGLDLSEINDDEVRNSKVGKIKEAPWYSAIK
PSCNLTLDLQKNNLVFIKPDMFKELERVECLKLSFNSISQPVNGSQFTNLVNVKHLDLSH
NRIDLYYGSAFRELPNLEHLDLSSNSYHFSLKGLGHQLTFIRRMHSLRYLSLANNKIADR
ITKMLESDSLNFLDFSRNRLDIMWQPGRNMYIMFFHRLTNLTLLDISRNFLKQIPAKALD
YFPRMLRALFINNNHLTSFNWTQLSNFKNLEILDLRGNYLTILAKSPSIPSASIIHKLDL
SDNRIYKIYRQFFDKAHRLTHLNLSHNSLQTIDEISIPYRLLKELKNLDIRGNPMLCTCD
STFYEFIFKFNISIPQVTNKVTCGSPNMFKGRSIFSRDVLLCSDELSPCLFALSFLTAFA
LMLLPIGKQFWGWDVWYTFYICSARFGGSVKDHGAESSDYDAFVIFDKEQANVADWVYNE
LRAHLEDKGIRKFKLCLEERDWVPGKTSIENLCNAVYKSKKTIFILSKYQPMNGMLRETF
FMAQQRLLEEKKDVVILILLDEVLKKSRYLQLRKRLCKKTVLFWPPNPFGQQYFWHKLRT
VLDKDNHQYYDKNFSVGFD
Download sequence
Identical sequences H3BGE4
ENSLACP00000020965 ENSLACP00000020965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]