SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021629 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021629
Domain Number 1 Region: 127-246
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.8e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 233-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000218
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 3 Region: 20-165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000033
Family Growth factor receptor domain 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000021629
Domain Number - Region: 275-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0298
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021629   Gene: ENSLACG00000019004   Transcript: ENSLACT00000021770
Sequence length 436
Comment pep:known_by_projection scaffold:LatCha1:JH126565.1:6300513:6348792:-1 gene:ENSLACG00000019004 transcript:ENSLACT00000021770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKEMKSSPTVLSKLLSLLSQQQCSAGFELDRRSGQCFDIDECRAIPDACRADMMCVNQNG
GYLCVPSTNPVYRRPYANPYPYPFPQPPPAPVPAPNFPSPCRFGYQMDDNNECIDIDECA
TDTHQCNPTQLCINTEGGYTCSCTEGYWLIEGQCLDIDECRYGYCQQLCANTPGSYSCTC
NPGFILNPDNRSCQDVDECAGESTCSQICFNTYGSFLCRCNAGYELAEDGINCIDMNECS
FSEFLCQHVCENRPGGYQCTCPSGYNLLDDSRSCQDIQECETGNNTCTSQQVCFNIPGTY
KCLNPIKCEDPYIQINENRCMCPAENSGCRDQPFTILYKYMDMVTGRSVPSDVFQMQATT
RYPGAYYIFQIKSGNEGREFYMRQTGPLSATLVMTRPVRGPQDIVLDLEMVTVNTVINFR
GSSVIRLTIFLSEYSF
Download sequence
Identical sequences H3BIA8
ENSLACP00000021629 ENSLACP00000021629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]