SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000023076 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000023076
Domain Number 1 Region: 654-722
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.05e-21
Family TB module/8-cys domain 0.0000187
Further Details:      
 
Domain Number 2 Region: 27-94
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.35e-19
Family TB module/8-cys domain 0.00054
Further Details:      
 
Domain Number 3 Region: 403-528
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-18
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 492-608
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-16
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 5 Region: 830-892
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.58e-16
Family TB module/8-cys domain 0.0023
Further Details:      
 
Domain Number 6 Region: 235-356
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000494
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 355-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000117
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 8 Region: 945-1032
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 740-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000019
Family EGF-type module 0.017
Further Details:      
 
Domain Number 10 Region: 773-818
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000287
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 11 Region: 601-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000442
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000023076
Domain Number - Region: 2-26
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00188
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000023076   Gene: ENSLACG00000010764   Transcript: ENSLACT00000025987
Sequence length 1041
Comment pep:known_by_projection scaffold:LatCha1:JH126700.1:531113:730403:-1 gene:ENSLACG00000010764 transcript:ENSLACT00000025987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSYRCTCKPGYMPDLTLSTCVPDNPMISEEKGPCFRFVSAGKQCMHPLSAQLSKQLCCC
SVGKAWGLHCEKCPLPGTAAFKEICPGGIGYTVTGPYKKIYHLGPSRVPTSGGVKTPVTH
AEPIATRAPLQARQEPVEALTSSEKHNPQGQQEVIIEKVTTAAPDKELTFFDEQEKLIVE
PGQPQLSPGISTINLDPRYPDLVLITSPPAPVKLPPETSTSSASQVIAPTQVTEINECTV
NRDICGRGYCINLPVGYTCICYAGYELNNQQTRCVDVDECTNRPRPCSNGRCENTVGSFH
CVCRAGFVANEERTNCTDIDECQDPSTCPSEVCVNSPGSYTCFPCPDGYKGRNNHCSDID
ECLESSVCANGKCSNLDGSFVCTCNQGYEPATDGKSCKDVDECLRGLLCTNGQCRNTEGS
FQCTCNPGFLLSAAGDQCEDIDECLEARNPCQGEGLCLNTEGSYQCVCRDGYQQMNSTMC
QDINECLLYEFCVEHGECLNTDGSFQCICELGFSLSADGRSCEDIDECSGPGSPCQEEGI
CMNTLGSYQCNCRDGFQQINSTMCEDINECLLSELCAPHGECLNTDGSFQCICEQGFSVS
ADERKCEDVNECEMLSGVCGEALCENVEGSFLCLCSNENQEYDPMTGQCRFRTVPEEKKE
CYYNLNDANFCDNVLTSNVTKEECCCTLGAGWGDNCEIFPCPVLGTAEYNALCPEGKGFI
PNKDSAYAVGGQTYKDADECMLFGEACKNGFCLNTEPGYECYCKQGHYYDPVKMQCLDID
ECLDEFSCVDGQCMNTEGSYNCFCIHPLVLDATGKRCFNPEESSEQTAETDVFEDICWQH
VSNDFVCSRPLHGRKTTYTECCCLYGDAWGMQCALCPNRELEDYAEICNLPSSWNRRAYG
QDALTAFNPDYPEPGAEYESQYSQPGTLPLFVGEDSQFNSFEGLRAEECGILNGCENGRC
VRVQEGYTCDCFDGYHLDMARMACVDVNECSELNHRMSLCKNAECINTEGSYKCVCLPGY
APSEQPNYCIPMNLDEDSELE
Download sequence
Identical sequences M3XK20
ENSLACP00000023076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]