SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000023513 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000023513
Domain Number 1 Region: 23-188
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.06e-40
Family CRAL/TRIO domain 0.0022
Further Details:      
 
Domain Number 2 Region: 251-389
Classification Level Classification E-value
Superfamily PapD-like 1.54e-36
Family MSP-like 0.0000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000023513   Gene: ENSLACG00000002217   Transcript: ENSLACT00000025565
Sequence length 459
Comment pep:known_by_projection scaffold:LatCha1:JH128675.1:40244:133384:-1 gene:ENSLACG00000002217 transcript:ENSLACT00000025565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDESFQWRKEFGVNDLSESVLPRWTFETGAVFLHGYDKEGNKLFWFKVKLHIKDAKTAL
EKKKYVAFWLERYAKREPGKYLTVVFDMMETGLSNIDMDFVRFVINCFKIYYPKYLSKMV
IFEMPWIMNAAWKIVRSWLGPEAVSKLKFASRSEIQEYISVEYLPPHMGGIDPFKYSYPP
LPDDDFQTPMCENGPIVSEDETEMKDDAELESKDTVDSNHNEEQMLKSKKVTFTEEVQCK
QEEHGKMKSIKKPVTVFKGPLVHISPAEELHFGSKESGERKCLIILNNVTKNPVAFKVRT
TAPEKYRVKPSNSSCEAGASLDIVVSLHGGSEASPQDRFLVMAAEIDQPVGAGTPDLAQF
WKELPRNKVMEHRLRCHVVESNKPAIASFSDSTLGSIPSKDSKEHLHLKLTKLLASNARL
EEQINQCIWFQQLLGVLVSLLVAITCSCLYLLLTNDDSK
Download sequence
Identical sequences M3XLA7
XP_006009772.1.90931 ENSLACP00000023513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]