SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261414616|ref|YP_003248299.1| from Fibrobacter succinogenes subsp. succinogenes S85

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261414616|ref|YP_003248299.1|
Domain Number 1 Region: 37-241
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.12e-71
Family Endonuclease I 0.000000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|261414616|ref|YP_003248299.1|
Sequence length 247
Comment Deoxyribonuclease I [Fibrobacter succinogenes subsp. succinogenes S85]
Sequence
MKVSASAVALILCVFAAFSFAKVDPEAAPRHYNYRDAGKQMRRIYYGELQETIYCGCRYL
DKKHVDFSTCNYKPRENPNRKSLERTKRIEWEHIVTAHNMGKHLPCWRDGGRKNCSANDT
TFKIMEGDLHNLYPAIGEVNGDRNNFMFSQWTNNPAPMYGECETIVDFKDKKVQPRKEVR
GLIARVHFYMEKTYNINISKQDRKLFEAWDKMYPVTERECERDRRIFKVQGDHNPFVFEK
CQDSVDK
Download sequence
Identical sequences C9RJV4
59374.Fisuc_0204 gi|261414616|ref|YP_003248299.1| gi|261414616|ref|YP_003248299.1| WP_012820047.1.27150 WP_012820047.1.74657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]