SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000000224 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000000224
Domain Number 1 Region: 3-122
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-25
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000000224   Gene: ENSLACG00000000203   Transcript: ENSLACT00000000226
Sequence length 249
Comment pep:novel scaffold:LatCha1:JH129431.1:676:200073:1 gene:ENSLACG00000000203 transcript:ENSLACT00000000226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGKKTPRGKRGWKTFYAVLKGTILYLQKDEYKPEKALSEEDLKNAISVHHSLAIKATDY
EKKPNVLKLKTADWRVFLFQAQNPEEMESWIKKINSVAAVFSAPPFPAAIGSQRKFSRPL
LPATTTKLSQDEQLKSHETKLKQIATELAEHRSYPPDKKVKAKEIDEYRLREHYLEFEKN
RYETYVKLLKEGGKELLSGIENDNSSLKKSHSSPSLNQEMSPASAKVKRNISERKDYRPE
APTTKQKIT
Download sequence
Identical sequences H2ZS53
ENSLACP00000000224 ENSLACP00000000224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]