SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000000625 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000000625
Domain Number 1 Region: 11-143
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.53e-54
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000452
Further Details:      
 
Domain Number 2 Region: 145-184
Classification Level Classification E-value
Superfamily E set domains 0.000000000824
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000000625   Gene: ENSLACG00000000557   Transcript: ENSLACT00000000628
Sequence length 185
Comment pep:novel scaffold:LatCha1:JH132257.1:3133:11530:-1 gene:ENSLACG00000000557 transcript:ENSLACT00000000628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSGGFLFSRQLHGYIESEPLTLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHETL
FSNTKVLEIPLLPDNNMKAIIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQ
PNGRTISLQVASNPIECSQRSAQELPLVEKQNLDSFPVTGGQTMILTGHNFLPDSKVIFV
EKAQG
Download sequence
Identical sequences H2ZTA4
ENSLACP00000000625 ENSLACP00000000625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]