SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000000689 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000000689
Domain Number 1 Region: 485-745
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.02e-79
Family Eukaryotic proteases 0.00004
Further Details:      
 
Domain Number 2 Region: 163-282
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.09e-35
Family Frizzled cysteine-rich domain 0.00012
Further Details:      
 
Domain Number 3 Region: 288-325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 9-49
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 363-400
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 6 Region: 87-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 49-86
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 329-361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 9 Region: 420-502
Classification Level Classification E-value
Superfamily SRCR-like 0.0000222
Family Scavenger receptor cysteine-rich (SRCR) domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000000689   Gene: ENSLACG00000000616   Transcript: ENSLACT00000000695
Sequence length 753
Comment pep:novel scaffold:LatCha1:JH127637.1:3561:97846:1 gene:ENSLACG00000000616 transcript:ENSLACT00000000695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNYYFLFSSVDCSEDQFRCNTGKCLEYNFVCDGYDDCGDLSDEHECDCNPEREHRCGEG
RCITVDWVCDGDHDCLDKSDEVNCSCSSEGLMECSNGECIPSTYLCDGDDDCKDGSDEEN
CTVHQDRNSCQPGNLSCIDASCSEPCNGSPYCENHTNGTNCSLCEPITLELCLNLPYNHT
VYPNYLGHKTQKEASTSWESSLFPALVQTNCYKYLMFFACTILVPKCDSESNQRIPPCRS
LCEHSKEHCESVLGIVGLQWPEDTDCSQFPEENSANETCLLPDEAVEECSPSHFKCKSGR
CVLVSRKCDGHADCEDDSDEKNCGCSERGLWECPVSKLCIKHTMICDGFSDCLDNADETN
CSTCKINELVCANYDCVHRNLWCDGKRDCADSSDEWNCVALSESSSSLSLLTIHKHASEY
LVCADDWQEELSQQACKQIGLGGPPVTQIMEDNDQSHHRKWLRLNSDWRNKNTSALQSLL
VKGKFCQSRSKISLLCTREDCGRRPAARMSKRILGGRTSRPGRWPWQCSLQNGPSGHICG
CVLIGKKWILTAAHCFEGRETASVWKVVFGINNLDHPSVFMQIRLVKQIILHPQYNRAVV
DYDVSIVELDEAINETSYVRPVCLPRKDQLVQPDTYCYITGWGHLGNRMPFKLQEGEVRI
ISQKQCQSYFDLKTITSRMLCAGFESGTVDSCMGDSGGPLVCETPENQWTLFGLTSWGSV
CFSKVLGPGVYSNVTHFVEWIEKQIYIRTFLLK
Download sequence
Identical sequences H2ZTG8
ENSLACP00000000689 ENSLACP00000000689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]