SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001190 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000001190
Domain Number - Region: 243-293
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0196
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001190   Gene: ENSLACG00000001066   Transcript: ENSLACT00000001201
Sequence length 552
Comment pep:novel scaffold:LatCha1:JH127395.1:9393:179208:-1 gene:ENSLACG00000001066 transcript:ENSLACT00000001201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVSPGFCWFLLGVMVSSVCTGSPTSKPKSCSEVRQLYNSKGYSLNGVPHTEISGEHLRV
CPQGYTCCTSEMEENFASLSRRELEGKVKEAGRSIQASLNTQYKNFDGYFQEVLNRSESS
LHEAFLGLYGDLYTQNTQLFKELYGELRRYYHGSNINLEEALTEFWTRLLERIFKQLNPQ
YQLTDEYLDCALKQAEQQRPFGETPRELKARATLAFIAVRSFIQGLSMASDVVRRVSQVP
LSPECTRAIMKLLYCPHCRGMSSVKGCQNYCHNVMKGCLANQADLDTEWRAFVDAMLQVS
DRFEGTSSVETVFGSIHVRISEAIFNLQENEEHIRAKVFQACGNPKANSRGSEGNEKKRM
KPVSDDTSAGHRLEKLVLDVKGKLGEMKHYWVALPSALCGNKITAGPTNEDRCWNGMTKS
RYLPEVMGDGLANQINNPEVDVDITKPDMMIRQQIMQLKIMTNRLRNAYKGNDIDFLDSS
DDISGSGSADGCPEETCKGSRKKVILSVAGQPKVLTRPLGTGSQGGGGGMALPSALTLTL
SWAVTLAHYLWR
Download sequence
Identical sequences H2ZUW9
ENSLACP00000001190 ENSLACP00000001190 XP_006002732.1.90931 XP_014347968.1.90931 XP_014347969.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]