SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001454 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000001454
Domain Number 1 Region: 28-147
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.19e-44
Family Frizzled cysteine-rich domain 0.000000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001454   Gene: ENSLACG00000001299   Transcript: ENSLACT00000001466
Sequence length 582
Comment pep:novel scaffold:LatCha1:JH126785.1:14835:16583:1 gene:ENSLACG00000001299 transcript:ENSLACT00000001466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECYLLEIYLIFALALFRRSRCATAKDMTCHEITVPLCKGIGYNYTYMPNQFNHDSQDEA
GLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQY
GFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTASPVFPKPTNHPAKPSNPHKGKVVPIR
PGSPGSKTRPSCQPGCQCRAPMVHVTSERHPLYNRVKTGQIPNCAMPCHNPYFTQDERTF
TAFWIGLWSVLCFVSTFATVATFLIDMERFKYPERPIIFLSACYMFVSVGYIVRLIAGHE
KVACNREYEVEHIHYETTGPALCTVVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEA
IASYSQYFHLAAWLVPSIKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVIYL
FIGTMFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTVLYTVPATIVVACYFYEQ
HHRQSWEMTHNCSCLMERETKRPDYAVFMLKYFMCLLVGITSGVWIWSGKTVESWRAFCT
RCCWGSKGTSGSMYSDVSTGLTWRSGTASSVSYPKQMPLSQV
Download sequence
Identical sequences H2ZVN3
ENSLACP00000001454 ENSLACP00000001454 XP_005994866.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]