SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000001995 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000001995
Domain Number 1 Region: 36-154
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.7e-41
Family Frizzled cysteine-rich domain 0.0000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000001995   Gene: ENSLACG00000001784   Transcript: ENSLACT00000002009
Sequence length 530
Comment pep:novel scaffold:LatCha1:JH128032.1:30043:38635:-1 gene:ENSLACG00000001784 transcript:ENSLACT00000002009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMHWISVFNFVAFSSTLFSCPIDLVGAFGDEEERLCDPIRISMCQNLGYNVTKMPNLVG
HELQSDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGSMCLSVKRKC
EPVLKEFGFIWPESLNCSNFPPQNDHNNMCMEGPGDDDVHYHSTKTDLQPGEDCHSVGSH
SRQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASFCFISTAFTVLTFLIDSSR
FSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAEEPVLIQEGLKNTGCAIVFL
LMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRL
VDADELTGLCYVGNQNTDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKT
DKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWNIFKSSADDSSMAVEMLKIFMSLLV
GITSGMWIWSAKTLHTWQKCSNKLVNSGKTKREKRADSWVKPGKGNETVV
Download sequence
Identical sequences H2ZX74
ENSLACP00000001995 XP_006007165.1.90931 ENSLACP00000001995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]