SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000002758 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000002758
Domain Number 1 Region: 46-166
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.58e-25
Family Frizzled cysteine-rich domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000002758   Gene: ENSLACG00000002467   Transcript: ENSLACT00000002780
Sequence length 820
Comment pep:novel scaffold:LatCha1:JH127498.1:49895:83317:-1 gene:ENSLACG00000002467 transcript:ENSLACT00000002780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRGEAFVKSFGMLLLWGCLLLGCRPGRAQENDSFALDECRRPAGCEPLKYNSCLGFPL
PYRHTAISLAEDSGSQEEIHHKLLLWSGLRNAPRCWEVIQPLLCAVYMPKCESGKVELPS
QILCQATRGPCAIVQRERGWPDFLKCTTDRFPEGCPNEFQSIKFNSSGRCEAPLVRTDNP
KSWYEDVEGCGIQCQNPLFTLGEHQDMHVYIAVFGSITIFCTFFTLATFVADWKNSNRYP
AVILFYVNACFFIGSIGWLAQFMDGARKEIVCRADGTMRLGEPTSNETLSCAIIFVIVYY
SLMSGVIWFVMLTYAWHTSFRALGTTYQPLMGKTSYFHLVTWSVPFVLTVAILALAQVDG
DSVSGICFVGYKNYHYRAGFVLAPIGLVLVIGGYFLIRGVMTLFSIKSNHPGLLSEKAAS
KINETMLRLGIFGILAFGFVFITFGCHFYDFFNQAEWEKSFREYVLIFLNVNFSDMRKAV
TACCGLRSFSVPEINCFFLTAMHVRESVWDFSFFFFFFFFCIMAKIIGRSDDEPKRIKKS
KMIAKAFSKRKELLQNPEKELSFSMQTVSHDGPVAGLNFDLNEPSADVSSAWAQHVTKMV
ARRGAILPQDISVTPVATPVPPEENKKNLWVVEAEIPPELHKKAGKKKKKKRKRKKEVQP
MDEVPHVGYYTEWVSSNVPRLPKLPGQKSLVSKVRQPEVAEEVLPGSFPEYKSTPYEGRF
QNGYLDYKRHTTLNLIANPLSDEEVPQMEPGFVSSRFHSPLGPYSGVFKSAVPEAEPSSF
PVGRLPYVPRTQTRRAVELAPIHSRTNLMDAELMDADSDF
Download sequence
Identical sequences H2ZZD7
ENSLACP00000002758 ENSLACP00000002758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]