SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005391 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000005391
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.99e-34
Family T-box 0.0000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005391   Gene: ENSLACG00000004796   Transcript: ENSLACT00000005439
Sequence length 101
Comment pep:novel scaffold:LatCha1:JH128364.1:139353:139655:1 gene:ENSLACG00000004796 transcript:ENSLACT00000005439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMFPQCKVSVNGLDPDYKYILLVDIVPVDNSRYKWQDKRWEASGKAEPLLPDRVYIHPDS
PANGAHWMRQAISFHKIKLTNNTLDQQGHVSITAMVSGLPT
Download sequence
Identical sequences H3A6X0
ENSLACP00000005391 ENSLACP00000005391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]