SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005687 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000005687
Domain Number 1 Region: 3-91
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.06e-26
Family Frizzled cysteine-rich domain 0.0000173
Further Details:      
 
Domain Number 2 Region: 116-197
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000392
Family Netrin-like domain (NTR/C345C module) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005687   Gene: ENSLACG00000005053   Transcript: ENSLACT00000005736
Sequence length 198
Comment pep:novel scaffold:LatCha1:JH128920.1:149846:166294:-1 gene:ENSLACG00000005053 transcript:ENSLACT00000005736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENAILAIEQYEELVAIDCSRVLRFFLCAMYAPICTLEFLHDPIKPPCKSVCQRARDGCEP
IMNRYNHSWPESLACEDLPVYDRGVCISPEAIVTDLPEDKIDQLTLILINLFTDHCRCRK
MKPTLTTYLQKNYTYIIHAKVKEINKSGCNEITTVVEVKETLKSSVPIVQTHVPLITNSS
CPCPELLPNQDLLIMCYE
Download sequence
Identical sequences H3A7R6
ENSLACP00000005687 ENSLACP00000005687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]