SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000006425 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000006425
Domain Number 1 Region: 220-325
Classification Level Classification E-value
Superfamily DEATH domain 3.1e-22
Family DEATH domain, DD 0.001
Further Details:      
 
Domain Number 2 Region: 98-143
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000707
Family TNF receptor-like 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000006425
Domain Number - Region: 47-95
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000848
Family TNF receptor-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000006425   Gene: ENSLACG00000005702   Transcript: ENSLACT00000006478
Sequence length 330
Comment pep:novel scaffold:LatCha1:JH129153.1:180546:208903:1 gene:ENSLACG00000005702 transcript:ENSLACT00000006478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFAFVTRVIFLPLVVTIVSSVGAGKEQNASFIHLYTKRLAKREITCCTHETTTDNRCCK
YCPKGHHINETCECEPCDIGTYLDERNCEEKCRRCDTCDLNEGLEEVTACNTIRNVVCQC
KENFYCTNTMAESCKECISCDKCKGSPHETICTSVCKLNGTLSKFRKTGSWWITTLVAVL
ILVAVAIAVAVGVRKYSLYQKGCNRKSECEDHALIFTLIADMSLTSYVPDIADELGINEI
KSFVRRNSVNQPVIDRIREEHAAVEEQRYQLMLAWYQQHGRTGAATVLISTLRKMNKNAA
ADSVLKKLENYSVNQANGSSSNNNMKGSNT
Download sequence
Identical sequences H3A9V4
ENSLACP00000006425 ENSLACP00000006425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]