SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000006566 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000006566
Domain Number 1 Region: 243-344
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.44e-23
Family Frizzled cysteine-rich domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000006566   Gene: ENSLACG00000005821   Transcript: ENSLACT00000006619
Sequence length 361
Comment pep:novel scaffold:LatCha1:JH126906.1:187113:188396:1 gene:ENSLACG00000005821 transcript:ENSLACT00000006619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPAMTSALPTPEKDKNIAGVGEQILNVAESIRNLVHRWDQQPTTTSTVGDYSVSPNTTSL
RSGPETSKVVGGSPAEEGVSTSRSGKFGASSEESVLKPSAEGETTKPTLVRGTPQPGSSS
PPVPFTGSLPNDSVTVVGSRPLESREQVGSPDPRNTASFHSSDASSFNTSKHHGIAMAEL
SRNESGLLSNTTVPDLVVGFTVLNDSEQIDFDLLITAEKSDPIIRSKDGSASIVVGMSLP
ASHCVPLPASLPFCAGLGVKSIALPNYLNQSGVVEIAETLREWAGLLGSHCHCRLEWFFC
LLLAPRCNASAPPCRGFCENLRDDCWMQLDAGRLPVSCDLLPEEEVADGYSCVSINFTKG
N
Download sequence
Identical sequences H3AA95
ENSLACP00000006566 ENSLACP00000006566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]