SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000006869 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000006869
Domain Number 1 Region: 49-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000981
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000109
Family Hairy Orange domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000006869   Gene: ENSLACG00000006098   Transcript: ENSLACT00000006928
Sequence length 339
Comment pep:novel scaffold:LatCha1:JH127470.1:201327:216017:1 gene:ENSLACG00000006098 transcript:ENSLACT00000006928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPCEETTSDSDMDETIDVGSENNYSGQSNGSLIRSNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGYRECLTEVARYLSSVEGLDTSDPLRVRLVSHLSTYASQREAAVMTSMAHHHHPLH
PHHWTAAFHHLPTALLQQTGLPSSETTLSRLSAMSEVPSTHSSALLTATFAHTDSALRVP
SAGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAQSFPLSFAGAFPMLPPCAAASVAASA
AAAISPTLSVPAASSPQQHSSGGANGKPYRPWGTEVGAF
Download sequence
Identical sequences H3AB48
ENSLACP00000006869 ENSLACP00000006869 XP_006003332.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]