SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007301 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007301
Domain Number 1 Region: 37-154
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.7e-39
Family Frizzled cysteine-rich domain 0.0000506
Further Details:      
 
Domain Number 2 Region: 169-285
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000000173
Family Netrin-like domain (NTR/C345C module) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007301   Gene: ENSLACG00000006474   Transcript: ENSLACT00000007361
Sequence length 294
Comment pep:novel scaffold:LatCha1:JH129143.1:219940:223946:1 gene:ENSLACG00000006474 transcript:ENSLACT00000007361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYNLYSLALVMLAASSCVKSVNGMYPFGQSEFSYKRSNCKPIPATLVLCHGIEYPNMRLP
NLLGHETMKEVLQQASSWIPLVQKQCHPDTKKFLCSLFAPVCIDDLDETIQPCRSLCEQV
KESCAPVMSAFGFPWPDMLECSRFPPDNDLCIPPASTEHFVPATKTVPKVCDACKSKEDN
DNEIAENLCKNDFALKIKVKEISYINGDTKIIPETKSKTIYKLNGVTERDLKKTVLWLKD
GLQCTCDEMNDINAPYLVMGQKLGGNLVITSVKRWQKGQKEFKRISRSIRKLQC
Download sequence
Identical sequences H3ACD0
ENSLACP00000007301 XP_006011139.1.90931 ENSLACP00000007301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]