SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008424 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000008424
Domain Number - Region: 157-196
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00301
Family Frizzled cysteine-rich domain 0.0074
Further Details:      
 
Domain Number - Region: 279-313
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.034
Family Hemolysin E (HlyE, ClyA, SheA) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008424   Gene: ENSLACG00000007458   Transcript: ENSLACT00000008492
Sequence length 477
Comment pep:novel scaffold:LatCha1:JH129173.1:277608:290482:-1 gene:ENSLACG00000007458 transcript:ENSLACT00000008492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NTFFPPNFPSEFFRELIEIAEKSLNEMFTQTYRHLYTQNARLFEDLFHDLLQYYLGAKVN
LEEALNEFWNRLLERMFQLVNPQYHFTEDYLECVSKHAEQLKPFGEVPRKLKIQRTGKTH
CAGRTITEKLKQKTRTVGRSAGMTPTRECQRAIMRMSYCPLCRGVPSLKPCSGFCRNVMK
GCLANQADLDTEWNNFIGALLLLAEKLEGPFNIEFAMDSISVKISEGIMYMQENSMQTST
KVFQGCGSPRPTPGRTKRSSRDDTKRRFRTYTSEEKPTTAAGTNLDRLISDMKEKLKAMR
RFWATLPNTLCNDEKVAADITNEDKCWNGQTPQTPRYLPDVRGDGLVNQINNPEVEVDIS
RPDARTRQQIMQLRMMTNQLRGAYNGNDIEFQDSYDEGSGSGGSEKYSEDWPGRRNTGPR
SDDARTPWREKPRRTNRLNQSGRRGGSGGNSSNGAGVLVSSSIALAVCAALVALLWR
Download sequence
Identical sequences H3AFK3
ENSLACP00000008424 ENSLACP00000008424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]