SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008828 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000008828
Domain Number 1 Region: 12-175
Classification Level Classification E-value
Superfamily RUN domain-like 1.57e-39
Family RUN domain 0.00045
Further Details:      
 
Domain Number 2 Region: 1208-1274
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.11e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1398-1444
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.00000301
Family Supernatant protein factor (SPF), C-terminal domain 0.013
Further Details:      
 
Domain Number 4 Region: 561-663
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000259
Family Myosin rod fragments 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000008828
Domain Number - Region: 658-766
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00107
Family Myosin rod fragments 0.0071
Further Details:      
 
Domain Number - Region: 1069-1138
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0126
Family SNARE fusion complex 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008828   Gene: ENSLACG00000007800   Transcript: ENSLACT00000008897
Sequence length 1464
Comment pep:novel scaffold:LatCha1:JH127567.1:299720:445038:-1 gene:ENSLACG00000007800 transcript:ENSLACT00000008897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAMAVSSGENQLQRIIKDLQGAATDLNIEFKENGEPITDDSENLHKFSFKLEYLLQFDQK
EKTTFLGSRKDYWDYFCDCLAKIKGANDGIRFVKSIPELKTSLGKGRAFIRYSLVHQRLA
DTLQQCIMNVKVTSDWYYARSPLVKPHLNSDIINHLYELNEVQFDVASRGHDLDSAWPTF
ARRTLGSLSSPAHSWKPPSRSSSISSLLSSYSQKTFRLNPYTSVIVFLTFLFFFFLHGYS
IQQVHEFPSSPDMNSSLAAEQLETLDELRIELDQSDLKHKQMQERIQQLEIEKQELQKLT
VLQEELQKCLQTLELSSSEKQKEYQTAVMQLETSNKGSASELMALTQELETAKVSEKTKE
CCIDELKIKLSFAEQKNLELISRIEEILNEKGQQTANHYDSALKIHELLDKLNEAEKEKS
ELQKVSSEQQTQLEKLAQDLKERDAIVKEHEEKVSAFSLNSAEENTNLVEELEKVNALLQ
GNLTLKENETANLQLQLQDSSKNFELLEKQYEEELEEARQEKEESQKMHENTKRSFEEQL
LNMNNTTRNLESQKSKLVCDKDNLNKTVQALEEKITKQRLAVEEISAENEKLQVQNQKLQ
QALKKCEGENKELVGSGASLETEVIRLKASEKQLQSQIDDAMVTVDEKEKKLRDENRTLD
ESLQNVIRQNKTLEDTLKKLQHDHDNLKGEISSLNSSLSLLQTEHRNAMQHVLELERNLL
VLEDNEETLKQQATEQDSVLQEKESYCKQLLERLERSEKKVSNLEKEKLSLEKTCMQQSK
LIESITAEKASVEKLQLEQRADQEKESQEINSRLSMTEKQLEVRINEVSRLQQEVISLRT
NLQQATEDQEKCQDKLNLSERSLEEYRLLVEQLKEQIESLNRSHVEEVVLFKEREELLRK
EKEEEACHRAELETSLLSLQQELSTFKQYAEKTKLENAETKDLLHRTNTEMAELGIQICA
LTSEKVDAKQNLAEAAARIQELSDMLVEEREKMNLEMCSLGQENESLHEKLGLSDGLAST
VKDLQAKLDKAEKLGKNLQETTKEEISAIKFQMSTEVMNCQSKLKTVSEELEDMKRELDE
RQTQISSLEEQLALLQALKTSLSQDVDQKSEQVQNKDEEVKLLEENLERTQKELEEAQKQ
IRESCDKLEEMQADKDRNELKLLAELDDLNRTKTYLEERLIELIRDKDVLWQKSDALEFE
QKLRAEERWLGDKEVNHCLDCKSQFTWWLRRHHCRLCGRIFCYYCCNNFAMTKHSGKKER
CCRDCFLQHGAISQRISEPGSPSEESSLDESPLLQAPMSLQAGSVTVTDEVSKQDDAAFD
IITDEELNQVKECDSLTQTEGQAQYTRELNEASHAMTPEEPSELMPVMQDAEICLLKSGE
LTLRLPLTVEDIFQFGESNKELFIKSSNYSVIPITVEETGLKINWLFSSDPKSISFSVVF
QESAETPLEQCKVYLQEGVVPLGC
Download sequence
Identical sequences H3AGQ7
ENSLACP00000008828 ENSLACP00000008828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]