SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008840 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000008840
Domain Number - Region: 252-319
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.00851
Family AlkB-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008840   Gene: ENSLACG00000007809   Transcript: ENSLACT00000008909
Sequence length 423
Comment pep:novel scaffold:LatCha1:JH126932.1:300527:339150:1 gene:ENSLACG00000007809 transcript:ENSLACT00000008909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQKQKLLKELGDKPLQYFTPKDAEFQHLWKTHYSKLLFKEANKTPHDLHEQVQSALLALL
DHGCFFQDLVRMKGKDIFTPISRLLIGIPGCTYKYLNTRLFAIPWPTSGKVVRYSDDQIF
KACQALLKLNDYLCTETVKALQEQSLAQAKEVEVTEKAATLSMLQDSVGFTKGRSPVVGD
QTNCSFELENRASFNVTLLNYMDPLKMVHLKDEPYFGMGKMAVSWHHDENLVERSTVAVY
SYSCKGRQSKTHSDFTVRNEGRDPVLWHVGLKRAWDIQTPGLAVPLLPGDCYFMLDDLNM
THQHCVLAGLQPRFSSTHRVAECSTGTLNYIFGRCQIALNNLRKDPSSGTLSLASFDLPV
LKQTEEIHNEVEFEWLRQFWFQGKRYGICSDWWYEPMAKMEDLWREMEIMVYLKKKKKEK
KQE
Download sequence
Identical sequences H3AGR9
ENSLACP00000008840 ENSLACP00000008840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]