SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008896 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000008896
Domain Number 1 Region: 109-272
Classification Level Classification E-value
Superfamily RUN domain-like 1.44e-51
Family RUN domain 0.0000000528
Further Details:      
 
Domain Number 2 Region: 618-707
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000312
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000008896
Domain Number - Region: 313-361
Classification Level Classification E-value
Superfamily Prefoldin 0.00628
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008896   Gene: ENSLACG00000007858   Transcript: ENSLACT00000008965
Sequence length 715
Comment pep:novel scaffold:LatCha1:JH127526.1:304235:417800:1 gene:ENSLACG00000007858 transcript:ENSLACT00000008965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPAAAAVAGGRAQETREVAESLQDAPGGGDRENWSVVYSRKPESSSVSSSSSLPRSPS
SFPCCPGEGSEEPGKVRFRAPERSPPVSPTHSNNSKRSCRNPKDPIAIERLNLMNMAKLS
IKGLIESALNLGRTLDSDYPPLQQFFVVMEHCLKHGLKTKKTFLVQNKSFWGPLELVEKL
TPEAGEITASVKDLPGLKTPSGRGRAWLRLALMQKKLSDYMKALINRKDLLSEFYEPNAL
MMEEEGAVIAGLLVGLNVIDANLCMKGEDLDSQVGVIDFSMYLKDGGHSSKNSEGDGQIT
AILDQKNYVEELNRHLNATVNNLQAKVDALEKSNTKLTEELAVANNRIITLQEEVERVKE
ASSYILESNRKAETVEVTNMAATSHLKFLVTKQDGTADGNMFSEARKQLKEETQLRLDVE
KELEVQIGMRQEMELAMKMLDKDVCEKQDALVALRQQLDDLRAFNYELVHKEQGSETAMK
QKNEIISRLEEKTSQMATTIKQLEQRLRQVEKDRQSAEDANRLFKQDFGDKIDSLQLEVD
HLAKQRVQLEVELKRERERRSILQNGNQGDKTPPTHLKNYQQELAELRKEFQKIETENLR
LRKALEERDQVVPDRGKKLKKKKKKLEYICSNTKETDEILYLMDQPSKPKEPVLCKLCQV
EASLTKRKNLCKNCGEMVCETCSVNELPLPSSIQPERVCNLCHAQLLQRYSTSPS
Download sequence
Identical sequences H3AGX5
ENSLACP00000008896 ENSLACP00000008896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]