SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000009097 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000009097
Domain Number 1 Region: 10-185
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.62e-67
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000232
Further Details:      
 
Domain Number 2 Region: 187-287
Classification Level Classification E-value
Superfamily E set domains 1.59e-27
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000009097   Gene: ENSLACG00000008030   Transcript: ENSLACT00000009166
Sequence length 288
Comment pep:novel scaffold:LatCha1:JH127745.1:315586:344784:-1 gene:ENSLACG00000008030 transcript:ENSLACT00000009166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSSALPPLDWPLPSQYEQYELKIEMQPRTHHRAHYETEGSRGAVKASPSGHPMVKLSGYN
EKPLTLQMFIGTADERNLRPHAFYQVHRITGKMVATSSYEAMAGSTKVLELSTLLDFDSL
ESIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQGNGKVVSLQTASVPIECS
QRSAQELPQIESYSINTCSVNGGEEVILTGSNFLPESKVIFIEKGPDGKLQWEEEAKVNR
IRSNESSLVVEVPQYYTKAVQRPIQVYFYVSNGKRKRSPTQSFRYLPG
Download sequence
Identical sequences H3AHH6
ENSLACP00000009097 ENSLACP00000009097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]