SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000009835 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000009835
Domain Number 1 Region: 2-72,101-248
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.37e-55
Family Protein kinases, catalytic subunit 0.0000000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000009835   Gene: ENSLACG00000008673   Transcript: ENSLACT00000009911
Sequence length 287
Comment pep:novel scaffold:LatCha1:JH127531.1:362045:405143:-1 gene:ENSLACG00000008673 transcript:ENSLACT00000009911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRD
IKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLIDFGLAKKYRDNR
TRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKNSI
LKFGAFEMASVTTAVFFFIKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNH
QYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKNNVKGF
Download sequence
Identical sequences H3AJL4
ENSLACP00000009835 ENSLACP00000009835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]