SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000010024 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000010024
Domain Number 1 Region: 300-586
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-75
Family Protein kinases, catalytic subunit 0.000000274
Further Details:      
 
Domain Number 2 Region: 141-229
Classification Level Classification E-value
Superfamily Kringle-like 1.16e-34
Family Kringle modules 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000010024
Domain Number - Region: 4-92
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.000916
Family Frizzled cysteine-rich domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000010024   Gene: ENSLACG00000008836   Transcript: ENSLACT00000010101
Sequence length 769
Comment pep:novel scaffold:LatCha1:JH127804.1:373576:410473:1 gene:ENSLACG00000008836 transcript:ENSLACT00000010101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENQITAAFTMIGTSNHLSDRCSQFAIPS
LCHFAFPFCDETSAAPRPRDLCRDECEILENDLCKTEYIFARSNPIILMRLKLPNCEDLP
QPDSPEAANCMRIGIPMAEPINKNHKCYNTTGVDYRGTASVTKSGRQCQPWNSQYPHVHS
YTAFRYPELNGGHSYCRNPGNQKDGPWCFTLDENVKMELCDITACELDSKEKNKMEILYI
LVPSVAIPLAIALLFFFICICRNNQKSSTPPAQRQPKPVRGQNVEMSMLSAYKPKSKAKE
LPLSAVRFMEEMGECAFGKIYKGHLYLPGMDHAQLVAIKTLKDFSSPQLWAEFQQEASLM
SELHHPNIVCLLGVVTQEQPVCMLFEFLNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSL
DHGDFLHISIQIAAGMEYLASHFFVHKDLAARNILVGEQLHVKISDLGLSREIYSSDYYR
VQTKSLLPIRWMPPETIMYNKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMIRK
RQLLPCPEECPPRMYSLMTECWHEIPVRRPRFKDIHSRLRSWEGLSSHTSSNTPSGGNAT
TQTTSLSASPVSNLSNPRYPNFMYPTQGLAQGQIAGYMGPPIPQNQRFIPVNGYPIPPGY
AAFPAAHYQPQGPPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNHDANTPLLSHT
SVSSHPSGTNIPIFGNKIQKPLKMDPPQASFLGDSIMPGHNEPMIAAEL
Download sequence
Identical sequences H3AK53
ENSLACP00000010024 ENSLACP00000010024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]