SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000011011 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000011011
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-36
Family N-terminal domain of xrcc1 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000011011   Gene: ENSLACG00000009690   Transcript: ENSLACT00000011093
Sequence length 206
Comment pep:novel scaffold:LatCha1:JH127506.1:441802:455230:-1 gene:ENSLACG00000009690 transcript:ENSLACT00000011093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVKIKHVVSFSSQDPKHPVENLLCEELARPWLCCPRERSGKLKVELQLERASHVGFID
VGNCGSALVQIDVGRSSWPLNKPYVTLLPATALMTPADAKLGRNRTGVRMFKEMKESPDM
QRKGWREDRRKLGADGGGGEPECLRKMRERVIASLGDAETPLFWGGRSGKFSSPLKLTPT
RASSEKGEPPASPWLANPAIQRTFFP
Download sequence
Identical sequences H3AMZ0
ENSLACP00000011011 ENSLACP00000011011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]