SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000013603 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000013603
Domain Number 1 Region: 4-130
Classification Level Classification E-value
Superfamily RUN domain-like 3.53e-30
Family RUN domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000013603   Gene: ENSLACG00000011975   Transcript: ENSLACT00000013699
Sequence length 393
Comment pep:novel scaffold:LatCha1:JH127016.1:658434:727302:1 gene:ENSLACG00000011975 transcript:ENSLACT00000013699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIETFCLLAHHTLFISGQITWFGYESPRSFWDYIRIACSKVPHNCISSIENLEHISYFKK
KGRAWIRVALMEKRLSEYISTALRENKITRRFYEDGAILMGEAANMVAGMLLGLNAIDFS
FCLKGEGLDGNFPAVIDYTPYLKFTQSSDSISSDEEELRTLGSSGSEGSTPENIGPPFVM
DENSWYNKCKRIEQKYRLALEQKGYLEELVRLREAQLSESATQNKLLLQRIDEANLSHNL
ERDQLEYIILELQDQLTIVKNNDQRSRQELTTHLTNQWPSPGALDANAVALDTLLYRKQN
GQWDEKSFQSLEQLSAEMSLSQTSLDPAHSQEGDSKLEGSTLQSGGKEDTPSLLGLCGSL
TSVASYKSLTSLKSSECLASPTTEMTSPGLTPS
Download sequence
Identical sequences H3AVD2
ENSLACP00000013603 ENSLACP00000013603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]