SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000014874 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000014874
Domain Number 1 Region: 44-158
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.06e-42
Family Frizzled cysteine-rich domain 0.00000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000014874   Gene: ENSLACG00000013091   Transcript: ENSLACT00000014978
Sequence length 557
Comment pep:novel scaffold:LatCha1:JH127399.1:807420:810059:1 gene:ENSLACG00000013091 transcript:ENSLACT00000014978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVFLLFPLCCLLADWSLTLLVFGTAGAAGQVNGERGISIPDHGYCQPISIPLCTDIAYNQ
TIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSLELKFFLCSMYAPVCTVLEQALPPCRSLC
ERARQGCEALMNKFGFQWPDSLKCEKFPVHGGSELCVGQNTSERNPAVFSTPSESYPGTI
NPPKYPKRDKFVCPRALKVPTYLNYHFLKEKDCGAPCESSRPNGLMYFSQEELKFSRIWI
GIWSVLCCASTLFTVLTYLVDMKRFSYPERPIIFLSGCYTMVAIAYIAGFLLEDKVVCND
KFGEEGYKTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEAN
SQYFHLAAWAVPAIKTITILAVGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGT
SFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGIFSVLYTVPATIVIACYFYEQAFRE
QWEKSWVTQTCKSYAIPCPSNSHPPMTPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSW
RKFYTRLTNNKQGETTV
Download sequence
Identical sequences H3AZ03
ENSLACP00000014874 ENSLACP00000014874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]