SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000014981 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000014981
Domain Number - Region: 167-215
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.000902
Family Frizzled cysteine-rich domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000014981   Gene: ENSLACG00000013185   Transcript: ENSLACT00000015086
Sequence length 263
Comment pep:novel scaffold:LatCha1:JH127395.1:820255:821892:-1 gene:ENSLACG00000013185 transcript:ENSLACT00000015086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSYTANSSVKLQRLYLTIQQNFFLSPETFDLLIGFAADHTCSLFDTTYGTMAKEARESV
KELFTDISLYILGSDNTVEEAVPRFFDSLFPLVYSRLINPGMSGMTEEYAECLRMTQQDV
NPFGPHPKAMVNKLSKSMQATRALSQALSVGVEVVTAMEQVAFTRDCSRALVKMQYCSHC
QGLTLIRPCAGYCLNVMRGCLASVAEVDIHWREYITMLDELTNDMAGSHDLELALLSVRN
LVNEAILHAQLNGPRLSATVSNM
Download sequence
Identical sequences H3AZB0
ENSLACP00000014981 ENSLACP00000014981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]