SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000015976 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000015976
Domain Number 1 Region: 44-157
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.72e-42
Family Frizzled cysteine-rich domain 0.0000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000015976   Gene: ENSLACG00000014068   Transcript: ENSLACT00000016087
Sequence length 555
Comment pep:novel scaffold:LatCha1:JH126818.1:957300:958967:1 gene:ENSLACG00000014068 transcript:ENSLACT00000016087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLKVSLHGALVWTVKVLILCDLFSGEAAGQYHGEKGISIPDHGFCQPISIPLCTDIAYNQ
TIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCTVLEQAIPPCRSLC
ERARQGCEALMNKFGFQWPERLRCEIFPVHGAGDICVGQNTTGVPTPGPSPHLPEPITLP
PFGRPSQPFTCPRQLKVPSYLNYHFLGEKDCGAPCEPTKTNGMMYFMEEEIKFARLWVGI
WSILCCFSTLFTVLTYLVDMKRFSYPERPIIFLSGCYFMVAVAYVVGFLLEDKVVCIDRF
ADDEYRTVAQGTKKEGCTILFMILYFFGMASSLWWVILSLTWFLAAGMKWGHEAIEANSQ
YFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGIYSVDSLRGFVLAPLFVYLFIGTSF
LLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQW
EKTWLMQTCKSFAVPCPVNDFAPMTPDFTVFMIKYLMTMIVGITSGFWIWSGKTLQSWRK
FYNKLSNNNHGETAV
Download sequence
Identical sequences H3B255
ENSLACP00000015976 ENSLACP00000015976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]