SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016182 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016182
Domain Number 1 Region: 24-134
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.28e-38
Family Frizzled cysteine-rich domain 0.0000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016182   Gene: ENSLACG00000014254   Transcript: ENSLACT00000016294
Sequence length 712
Comment pep:novel scaffold:LatCha1:JH127169.1:992137:1044831:-1 gene:ENSLACG00000014254 transcript:ENSLACT00000016294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLALIVVFLMGFPLVHTHSLFTCEPITVPRCLGMSYNMTFFPNMMGHYDQDAAAVKME
PFFPLMNLHCSPEVHTFLCKAFIPVCTDHDCVVQPCRSLCEQVYSDCQNLIHTFGITWPE
ELECDKLENCGDTLPGTILPTSKSHSIPKTPELQRDYGFWCPRQLKTTPGQGSVFLTVND
CAPPCPNMYFKSNELDFAKSFIGIFSIFCLCATLFTFLTFLIDVRRFRYPERPIIFYAVC
YSIVSLMYFVGFLLGNSTACSTADEKLGTTETVVIGSQNKACTVLFMILYFFTMAGTVWW
VILTITWFLAAGPKWSCEAIEKKAVWYHTAAWGSPGILTVMLLAMNKVEGDNISGVCYVG
LYDLAALRYFVLVPLCLCVVVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVALLGCYIYEQAYRTAWESTWIFDHCQEYHIPCPSQVKSMTRPDLSLFMMKY
VMTLIMGISAVFWVGSKKTCSEWANFFNRNRKRDPISESRRVLQESCEFFLKHNSKVQHK
KKHYKSSSHKLKVISKSMGTSTGRTANHGTSVVAITNHDSLAQGSFTEPKPTPEIAITTV
GEHSITGQKINVDGGEPSTQVISGRTVSLDLQEKRSSKAGSTGKYKKIMFKNSEGQLSPR
NDFGEGHPLQSNQAQRPNCSRSSSIRGSVPLLMHSAPDTKEKETSVQCHKDA
Download sequence
Identical sequences H3B2R1
ENSLACP00000016182 ENSLACP00000016182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]