SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016580 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016580
Domain Number 1 Region: 86-155
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.32e-17
Family HLH, helix-loop-helix DNA-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016580   Gene: ENSLACG00000014612   Transcript: ENSLACT00000016694
Sequence length 221
Comment pep:novel scaffold:LatCha1:JH126627.1:1061960:1066281:-1 gene:ENSLACG00000014612 transcript:ENSLACT00000016694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMELYEANSCFQDQNYFNNENTSVLTNYDDFIPLEEGKDSEESLKASSVCTAIEEHVFAP
PGFHHTTGQCLLWACKICKRKSVTMDRRKAATLRERRRLKRVNEAFETLKRKTVPNPNQQ
LPKVEILRSAIQYIARLQSLLKSLNEQNAVSVNRNVSCQSNSQHGNDCPWGSSSVTNWEQ
EENKHSSFAYSGHKEAGTKDSTGAASLQCLSSIVDSISLQE
Download sequence
Identical sequences H3B3V9
ENSLACP00000016580 ENSLACP00000016580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]