SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017951 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017951
Domain Number 1 Region: 4520-4706
Classification Level Classification E-value
Superfamily UBC-like 5.11e-39
Family UBC-related 0.0011
Further Details:      
 
Domain Number 2 Region: 234-331
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.75e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0003
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000017951
Domain Number - Region: 22-112,264-371
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000118
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 
Domain Number - Region: 338-379,667-703,801-821,857-921
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0147
Family WD40-repeat 0.038
Further Details:      
 
Domain Number - Region: 2275-2332
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0589
Family Frizzled cysteine-rich domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017951   Gene: ENSLACG00000015816   Transcript: ENSLACT00000018081
Sequence length 4819
Comment pep:novel scaffold:LatCha1:JH126700.1:1365658:1807705:-1 gene:ENSLACG00000015816 transcript:ENSLACT00000018081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAASPASDWIVLRDGCLRCDEDGLHSLSYHPALNAILAVTSQGSIKVIDGTSGAILQASA
MHAKPGARVKCQYFSTVDKVVFVDDYAVGCRKDLNGILLLDTALQTPVSKQEDVVHLEVP
VTEAQQLLSACLEKVDVSNTEGYYQFFMQLKDGLKNISHETAANHKVAKWATVTFHLPHH
VLKSVANAIVNELKKVNLNVAALPVASSIMDRLSYLLPSARPELGVGPGRSADRSLMYSE
ANRRETFTSWPHVGYRWAQPDPMAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWS
EHERHSPNCPFVKGEHTQNVPLSVTLATSPAQFPNADGTDRIACFGFGSCPYFLAAATKR
GKICIWDVSKIMKVYLKFEVNAYDPAIVRQLVLSGGEQGPGLDSRRPTLAWLEDSSSCSD
IPKLEGDSDDQLEDSDSEERSRSESVTGHTSQKESMEVSLDITALSILQQPEKLQWEIVA
NVLEDTVKDLEELGANPSLSSSKSDKPKEKHSEQRNIPFPCLLAGGLLSYKSAAASPVSS
NSRRSLDLLSRTQGENMSEQGSTDNESCSNSELSSPLVRRTLPLLLLYSIKESDEKVGKV
FAQMNNIMSKSLHDEGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADATTNLVSIDSEK
WNSVVPMPGTLVQCLRLPKFAEEENLCVDSVTPCADGVHLLIGLRTCPAESLSAINQVEA
LNNLNKLNSALCSTRKGDIESNLSIVNGTDNSVIQQGAPSDAQTPLLIQPEHRQVSGGYL
LLYKMNYATRIVTLEEEPVKIQHIKEPQDAITSLILLPQDVLDNREDDCEEPSEEMPLNS
KNGSARERKSEMSSLGHLVVTTQGGFVKILDLSSFELLAKVEPPKKEGTDEADPFVSVIY
CSGTDRLCACTKEYELSFRDFSSYCNSYEFLKLCIEGRGCRKGIPPCSNGKSPLYWPHPP
SMGTRYNTGVELLVDQPFATETLTSLVELTRFETLTPRFSATVPPCWVEVQQEQQQRRHP
QHLHQQHHGDAAQHTRTWKLQPDSNSWDEHVFELVLPKACMVGHVDFKFVMNSSITNIPQ
IQVTLLKNKAPGLGKVNAPAVTAEAERNGQPGLTDEEMELDESQGPRLCQFLEDHKEDIL
CGPVWLGSGLDLSGHAGMLTLTSPKLVKGMAGGKYRSFLIHIKAVHDRVAEENSNGGIRP
VVRMPASKPQSSKGHSLSSLLAKVAAGKEKPSTSKTKSNSNSRKNDNLKGCDLLQEVSVT
IRRFKKTYIPKERVQRCAMLQFPEFHDRLLDTLCKRIDDGPATEHVQSLVLDILCWLAGV
TSIGPGSALREGKESLLGKTRRLLTDIVRVCFFEAGRSIAHKCARFLALCISNGKVDRSQ
QGFGSALLKALLDNLPYLPAAAAGGSVFWYFVLLNYVKDEDLAECSTACASLLTAVSKQL
QDRLTPLEALLQTRYGLYSSPFDPVLFDLEMSGSSCKNTYNSSIGVQSDEIDLSEVLSGN
GKLSSCAAAEGSFTSLTGLLEVEPLHFTCVSTSDGTRVERDDAMSTFGVTPTVGGLSSGT
VGEASTALSSAAQVALQSLSHAMASAEQQLQVLQEKQQQLLKLQQQKAKLEAKLHQTTAA
AAAAASAVGPIHNSVPSNPTTVPGFFIHPSDVIPPTPKTTPLFMTPPLTPPNEAVSAAIS
AELAQLFPGSVIDPPAVNLAAHNKNANKSRTNSLGTGLALAISHASHFLQPPPNQSIIIE
RMHSGARRFVTLDFGRPVLLKDVLIPTCGDLASLSIDVWTLGEEVDGRRLVVATDISTHS
LILHDLLPPPVCRFMKITVIGRYGSTNARAKIPLGFYYGHSYILPWESELKLMHDPLRGE
SDSTNQPDIDQHLAMMVALQEDIQCRYNLACHRLETLLQNIDLPPLNSANNAQYFLRKPD
KAVEEDSRVFSGYQDCIQLQLQLNLAHHAVQRLKVALGASRKTLPEVYNPKELIQNSSTE
QLRTIIRYLLDTLLSLLHSSNGHSVPSVLQSTFHAQACEELFKHLCISGTPKIRLHTGLL
LVQLCGGERWWGQFLSNVMQELYNSEQLLIFPQDRVFMLLSCIGQRSLSNSGVLESLLNL
LDSLLSPLQPQTFAHRRTEGVLDIPMISWVVMLVSRLLDYVEDEAGSSKKSLGRNQWSFI
NNSLQSQSLSRSSKGNSSLDRLYSRKIRKQLVHHKQQLNLLKAKQKALVEQIEKEKIQSN
KGSSYKLLVEQAKLKQATSKHFKDLIRLRRTAEWPRCNIDTDVPPAKETPEVEPLPFTLA
HERCISVVQKLALFLLSMDFTCHADLLLFVCKVLARIANATRPTIHLCEIVNEQQLERLL
LLLVGTDFNRGDISWGGAWAQYSLTCMLQDILAGELLSSVTADVMEEGAVGEEASASAGD
SDDSLQQPSSVPLVETIDEPLTPDITAKGAPPLSTLEKDKDIDFDLLQDLMNIDIDPLDV
DLEKDPLAAKVFKPISNTWYDYWGADYGAYNYNPYIGGVGIPVAKPPATSEKNGSQNVSI
SVSQALDARLEVGLEQQAELMLKMMATLEADSILQALTSSSPTISQAPNETDDSLLRGLQ
ASNQASQLIVQPSSVPMLSACFNKLFSMLLVHHVQLESLLQLWLTLSLNSSSTGSEENGT
DIFLFNSSRMPAILLNQASITSFLTVLAWYPNTSLRTWCLVLHSLTLMTNMQLNSGPTSG
MGAQESTAQLMVSDPNLIHVIVRFLSGTNPHGTSQHSPQVGPTATQAMQEFLTRLQVHLS
STCPQMFSEFLLKLMHILPSERGPFQSGQGPLDAQVKLLEFTLEQNFEVVSVSNISAVIE
SVTFLVHHYITCSDKVISRSGSDSSVGARACFGGLFANIIRPGDAKAVCGEITRDQLMFD
LLKLVNILVQLPLSSDREYSARIPVASSATDSVSDEEKASGSKDGNGSTSASQGTTVCVA
DLVLANQQIMSQILSALGQCNSSAMAMIIGASGLHLTKHENFHGGLDAISVGDGLFTILT
TLSKKATSVQVMLQPILTYMACGYMGRQGSLSTCQLSEPLLWFILRVLDTTEALKAFHDM
GGVQLICNNMVTSTRAIVNTARSMVSTIMKFLDSGPGKTTDGSLKARVLASEPDNAEGLH
NFAPLGTITSSSPTAQPAEVLLQATPPHRRARSAAWSYIFLPEEAWCDLTIYLPAAVLLK
EIHIQPHLASLATCPSSVSIEISADGVNMLPLSTPVITSGLTYIKMQLVKAEVASAVCLR
LHRPRDANTLGLSQIKLLGLTAFGSTSSATVNNPFLPSEDQVSKTSIGWLRLLHHCLTHV
SELEAMMASAAAPTANLLQTCAALLMSPYCGMHSPNIEAVLVKIGLQSTRIGLKLIDILL
RNCAASGTNPSDLNCPLLFGRLNGLSSDSTIDILYQLGTTQDTGTKERIQALLKWVHDSA
VVAALKRSGHIGCINPNNPTREYGLLMPSPSHLHCVAVILWHSYEMPVDYDLPALINREL
FELLYKWSMSLPCNIVLKKAVDSLLCSMCHIHPTYFVLLMGWMGITPPPVQSQHRLSMTD
DNKKEDLRCGLTDDSKNAQAPIALTESHLATLAASSQSPEAIKQLLDSGLPSLLVRSLVS
FCLSHLSSFDCAMLSADAHADRLRRHHSQQHLVSKLPLTADLVAPVLRFLTEVGNSHIMK
DWLGGPEVNPLWTALLFLLCHSSASTGGGPAGAQQASARSFPSSATGTGLNTQQRTAVEN
AAVAFFLQCISCHPNNQRLMAQVLCELFQSSPQRGNIPTAGNISGFIRRLFLQLMLEDEK
VTMFLQSPCPLYKGRINATSHVIQHPMYGAGHKFRTLNLPVSTTLAEVLDRVSDTPSITA
KLINEQKDDKEKKNPEEKEKLKTENGFQDNYSVVVASGLKSQSKRAVSSTPPRPPSRRGR
MMPEKLTSSSSGAESVNKTISVPVFHLYHKLLPGQPLPAEMTLAQLLTLLYDRRLPQGYR
SIDLTVKLGSKLISDPSLSKTDSFKRLRTEKVDHSDVLSSCPDDEASAQNDECMDAVMDD
SLLETNPIQSPLQVFAGMGGLALIAERLPMLYPDVIQQVSAPVVASTTQEKPKDTDQFEW
VTIEQSGELVYEAPETIAAEPPPIKSTVQTMSPIPAHSLAAFGLFLRLPGYAEVLLKERK
HAQCLLRLVLGVTDDGEGSHILQSPSANVLPTLPFHVLRTLFSTTPLTTDDGVLLRRMAL
EIGAINLILACLSALSHHAPRVPNSNSSQTEPQVTTTHSSASAEEQQLYWAKGTGFGTGS
TASGWDVEQALTKQRLEEEHVTCLLQVLASYINPSGCTTPGEAEPGVCRGQNSNALPSVL
LELLSQSCLIPAMSSYLRNDSVLDMARHVPLYRALLELLRAIASCTSLVPLLLPLSGETG
DEDEDQSESQASVGTLLAKMKTCVDTYTNRLRSKKDKSKVGVKTDSSDPEPEGLTLLVPD
IQKTAEIVSGATTSLRQANQEKKLAETSRKIATKPKPLSILRSLEEKYVAAMKKLQFDTF
EMVSDDDGKLVFKVNYHYKSQVKNASDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRC
DEERLDIMKVLITGPADTPYANGCFEFDVYFPQDYPNSPPLMNLETTGGHSVRFNPNLYN
DGKVCLSILNTWHGRPEEKWNPQTSSFLQVLVSVQSLILVAEPYFNEPGYERSRGTPSGT
QSSREYDGNIRQATVKWAMLEQVRNPSPCFKEVIHRHFYLKRAEIMAQCEEWIADIQQYS
SDKRVGRTMSHHAAALKRHTAQLREELLKLPCPDGLEPEREESPERNGGATACCENETSS
AEYDKPSSSKETCPGDVKL
Download sequence
Identical sequences H3B7T0
ENSLACP00000017951 ENSLACP00000017951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]