SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018080 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018080
Domain Number 1 Region: 55-181
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.2e-67
Family RUNT domain 0.000000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018080   Gene: ENSLACG00000015930   Transcript: ENSLACT00000018211
Sequence length 191
Comment pep:novel scaffold:LatCha1:JH126701.1:1402267:1432418:-1 gene:ENSLACG00000015930 transcript:ENSLACT00000018211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVVMRIPVDTVTSRRFTPPSTTLSPGKMSEVLPLAGQDSSAALAGKLRTTDRNMVEVLAD
HPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAEL
RNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTSLPQVATYHRAIKITVDGPREPR
SKYLWPGYHHR
Download sequence
Identical sequences H3B859
ENSLACP00000018080 ENSLACP00000018080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]