SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018474 from Latimeria chalumnae 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018474
Domain Number 1 Region: 307-422
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-37
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 2 Region: 151-260
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-32
Family Spermadhesin, CUB domain 0.00066
Further Details:      
 
Domain Number 3 Region: 473-586
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.49e-26
Family Frizzled cysteine-rich domain 0.0004
Further Details:      
 
Domain Number 4 Region: 423-463
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000288
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 265-302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018474   Gene: ENSLACG00000016267   Transcript: ENSLACT00000018607
Sequence length 588
Comment pep:novel scaffold:LatCha1:JH126582.1:1509329:1523616:1 gene:ENSLACG00000016267 transcript:ENSLACT00000018607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEFTKIIVDGDSMSNTKTVYCNPTFEPDPGNDSIEVLTPEQEINKKENPLHKIVLRHTN
QRCPSRLPVLTFATCILVSVLGIIVTLVIFFSLHKAKQPALTDESPLPVTDILVTPSTPA
GPITFGPTMAGTGAPGDKAQASTSHPCESMCGATLEGNEGSLSSPNYPASYPPNLRCVWW
IQVGAGFVIQFKIDSLSLEGAMPCLFDSVELYEESDVSSRRFCGNVVPPTINTNTSRLRV
VFASDSSVAASGFTAQYRAIPPTEKDCAVEEFLCDAGRCLLLSFLCDSFYDCGDHSDESN
CTHKLKECGGLLTRAEGTFSSPEHPNLYPHQQLCLWQILVSEGHVIELTFQNFSLEESHP
GCNFDFVEIHDGTGANAGNLLGRYCGSQLPPPLTSSRHVMTVLFIADDDITDSGFFATYR
AINTTERSCNPTEFSCFNGECQALDWVCDGWNDCLDGSDELNCSITNYPPFVSSCEPVEV
EMCQGLSYNETSFPNIWLQVPDQQSAMKILKDYKILMELFCYQHLRLLICSLFIPKCSAE
GGVLQPCRSVCLSAENQCQHSLSLLGILWPFNCNMLPDSNDPTECVKP
Download sequence
Identical sequences H3B9A3
ENSLACP00000018474 ENSLACP00000018474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]